Recombinant Human TFAP2B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q92481

Gene Name: TFAP2B

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Lys21

End Site: Ser120

Coverage: 0.21

Isoelectric Point: 6.5

Core Sequence: KYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 75%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Transcription factor AP-2-beta; AP2-beta; Activating enhancer-binding protein 2-beta

Protein name: transcription factor AP-2 beta

Full length: 460 amino acids

Entry name: AP2B_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3695-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3695-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 7021