Recombinant Human TFG Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q92734

Gene Name: TFG

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Gln101

End Site: Asp190

Coverage: 0.26

Isoelectric Point: 5.5

Core Sequence: QVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDD

Homologies: Highest protein sequence identity to the following orthologs: Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Protein TFG; TRK-fused gene protein

Protein name: trafficking from ER to golgi regulator

Full length: 400 amino acids

Entry name: TFG_HUMAN

• Artikelnummer: ASBPP-340-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-340-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 10342