Recombinant Human THOC3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96J01

Gene Name: THOC3

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ser101

End Site: Trp190

Coverage: 0.27

Isoelectric Point: 6

Core Sequence: SVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 38%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: THO complex subunit 3; Tho3; TEX1 homolog; hTREX45

Protein name: THO complex subunit 3

Full length: 351 amino acids

Entry name: THOC3_HUMAN

• Artikelnummer: ASBPP-10397-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10397-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 84321