Recombinant Human TMEM183BP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q1AE95

Gene Name: TMEM183BP

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Arg21

End Site: Gly130

Coverage: 0.30

Isoelectric Point: 7.5

Core Sequence: RGKRLKFRAHDACSGRVTVADYADSDLAVVRSGRVKKAVANAVRQEVKSLCGLEASQVPAEEALSGAGEPYDIIDSSDEMDAQEENIHERTVSRKKKSKRHKEELDGAGG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 90%, Pig - 90%, Cynomolgus monkey - 96%

Alternative gene names: C1orf37-dup; TMEM183B

Alternative protein names: Putative transmembrane protein 183BP; Transmembrane protein 183B pseudogene

Protein name: transmembrane protein 183B, pseudogene

Full length: 376 amino acids

Entry name: T183B_HUMAN

• Artikelnummer: ASBPP-3419-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3419-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 653659