Recombinant Human TRAC Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P01848

Gene Name: TRAC

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Leu11

End Site: Glu100

Coverage: 0.77

Isoelectric Point: 4.5

Core Sequence: LRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Pig - 48%, Cynomolgus monkey - 82%

Alternative gene names: TCRA

Alternative protein names: T cell receptor alpha chain constant

Protein name: T cell receptor alpha constant

Full length: 140 amino acids

Entry name: TRAC_HUMAN

• Artikelnummer: ASBPP-3536-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3536-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 28755