Recombinant Human TULP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O00295

Gene Name: TULP2

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Glu141

End Site: Ser250

Coverage: 0.23

Isoelectric Point: 5

Core Sequence: EVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDS

Homologies: Highest protein sequence identity to the following orthologs: Pig - 54%, Cynomolgus monkey - 88%

Alternative gene names: TUBL2

Alternative protein names: Tubby-related protein 2; Cancer/testis antigen 65; CT65; Tubby-like protein 2

Protein name: TUB like protein 2

Full length: 520 amino acids

Entry name: TULP2_HUMAN

• Artikelnummer: ASBPP-3403-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3403-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 7288