Recombinant Human VAMP5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95183

Gene Name: VAMP5

Expression System: Escherichia coli

Molecular Weight: 50.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Gln11

End Site: Arg70

Coverage: 0.61

Isoelectric Point: 5.5

Core Sequence: QQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 76%, Pig - 79%, Cynomolgus monkey - 80%

Alternative gene names: /

Alternative protein names: Vesicle-associated membrane protein 5; VAMP-5; Myobrevin

Protein name: vesicle associated membrane protein 5

Full length: 116 amino acids

Entry name: VAMP5_HUMAN

• Artikelnummer: ASBPP-3631-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3631-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 10791