Recombinant Human VRK3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IV63

Gene Name: VRK3

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: His31

End Site: Asp160

Coverage: 0.28

Isoelectric Point: 11

Core Sequence: HVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Pig - 61%, Cynomolgus monkey - 87%

Alternative gene names: /

Alternative protein names: Inactive serine/threonine-protein kinase VRK3; Serine/threonine-protein pseudokinase VRK3; Vaccinia-related kinase 3

Protein name: VRK serine/threonine kinase 3

Full length: 474 amino acids

Entry name: VRK3_HUMAN

• Artikelnummer: ASBPP-10408-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10408-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 51231