Recombinant Human XIAP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P98170

Gene Name: XIAP

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Cys351

End Site: Ser430

Coverage: 0.18

Isoelectric Point: 5.5

Core Sequence: CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 82%, Pig - 88%, Cynomolgus monkey - 99%

Alternative gene names: API3; BIRC4; IAP3

Alternative protein names: E3 ubiquitin-protein ligase XIAP; Baculoviral IAP repeat-containing protein 4; IAP-like protein; ILP; hILP; Inhibitor of apoptosis protein 3; IAP-3; hIAP-3; hIAP3; RING-type E3 ubiquitin transferase XIAP; X-linked inhibitor of apoptosis protein; X-linked IAP

Protein name: X-linked inhibitor of apoptosis

Full length: 497 amino acids

Entry name: XIAP_HUMAN

Product panel: E3 Ligase,Enzyme

• Artikelnummer: ASBPP-358-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-358-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 331