Recombinant Human YIPF1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y548

Gene Name: YIPF1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Glu11

End Site: Val110

Coverage: 0.36

Isoelectric Point: 4

Core Sequence: EFGNAATSLTANPDATTVNIEDPGETPKHQPGSPRGSGREEDDELLGNDDSDKTELLAGQKKSSPFWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 83%, Pig - 92%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Protein YIPF1; YIP1 family member 1

Protein name: Yip1 domain family member 1

Full length: 306 amino acids

Entry name: YIPF1_HUMAN

• Artikelnummer: ASBPP-3625-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3625-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 54432