Recombinant Human ZNF138 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P52744

Gene Name: ZNF138

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 55%

Start Site: Met91

End Site: Ile180

Coverage: 0.39

Isoelectric Point: 10.5

Core Sequence: MHKFSNSNRHKIRHTENKHFRCKECDKSLCMLSRLTQHKKIHTRENFYKCEECGKTFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 55%, Rat - 49%, Pig - 49%, Cynomolgus monkey - 73%

Alternative gene names: /

Alternative protein names: Zinc finger protein 138

Protein name: zinc finger protein 138

Full length: 262 amino acids

Entry name: ZN138_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3565-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3565-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 7697