Recombinant Human ZNF250 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P15622

Gene Name: ZNF250

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 43%

Start Site: Asn101

End Site: Asn170

Coverage: 0.14

Isoelectric Point: 5.5

Core Sequence: NLKYDHTTACTQQDSLSCPWECETKGESQNTDLSPKPLISEQTVILGKTPLGRIDQENNETKQSFCLSPN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 43%, Pig - 49%, Cynomolgus monkey - 93%

Alternative gene names: ZNF647

Alternative protein names: Zinc finger protein 250; Zinc finger protein 647

Protein name: zinc finger protein 250

Full length: 560 amino acids

Entry name: ZN250_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3586-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3586-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 58500