Recombinant Human ZNF439 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NDP4

Gene Name: ZNF439

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 31%

Start Site: Lys111

End Site: His180

Coverage: 0.17

Isoelectric Point: 9.5

Core Sequence: KKKASPEVKSCDSFVCEVGLGNSSSNMNIRGDTGHKACECQEYGPKPWKSQQPKKAFRYHPSLRTQERDH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 31%, Rat - 31%, Pig - 47%, Cynomolgus monkey - 80%

Alternative gene names: /

Alternative protein names: Zinc finger protein 439

Protein name: zinc finger protein 439

Full length: 499 amino acids

Entry name: ZN439_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3486-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3486-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 90594