Recombinant Human ZNF442 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H7R0

Gene Name: ZNF442

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Asp11

End Site: Thr160

Coverage: 0.24

Isoelectric Point: 5.5

Core Sequence: DLFLPDSQTNEERKQYDSVAFEDVAVNFTQEEWALLGPSQKSLYRDVMWETIRNLDCIGMKWEDTNIEDQHRNPRRSLRCHIIERFSESRQPDSTVNEKPPGVDPCKSSVCGEIMGCSFLNCYITFDAGHKPDECQEYGEKPHTHKQCGT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 60%, Pig - 52%, Cynomolgus monkey - 88%

Alternative gene names: /

Alternative protein names: Zinc finger protein 442

Protein name: zinc finger protein 442

Full length: 627 amino acids

Entry name: ZN442_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3383-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3383-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 79973