Recombinant Human ZNF468 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5VIY5

Gene Name: ZNF468

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ala111

End Site: Ser200

Coverage: 0.19

Isoelectric Point: 9

Core Sequence: APMTEIKELAGSTGQHDQRHAGNKRIKDQLGSSFHLHLPEPHIFQSEGKIGNQVEKSINNASSVSTSQRICCRPKTHISNKYGNNSLHSS

Homologies: Highest protein sequence identity to the following orthologs: Pig - 33%, Cynomolgus monkey - 84%

Alternative gene names: /

Alternative protein names: Zinc finger protein 468

Protein name: zinc finger protein 468

Full length: 522 amino acids

Entry name: ZN468_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3401-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3401-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 90333