Recombinant Human ZNF511 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NB15

Gene Name: ZNF511

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Arg161

End Site: Ser230

Coverage: 0.32

Isoelectric Point: 9

Core Sequence: RKDHMVRMHLYPADFRFDKPKKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAGERRIYRHRIPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Pig - 60%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Zinc finger protein 511

Protein name: zinc finger protein 511

Full length: 252 amino acids

Entry name: ZN511_HUMAN

Product panel: E3 Ligase,DNA binding & Chromatin

• Artikelnummer: ASBPP-3493-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3493-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 118472