Recombinant Human ZNF512B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96KM6

Gene Name: ZNF512B

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Asn751

End Site: Glu850

Coverage: 0.12

Isoelectric Point: 10

Core Sequence: NCPNDCCEAIYSSVSGLKAHLASCSKGAHLAGKYRCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPKHRSQDSLVPKKEKKKNLAGGKKRGRKPKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Pig - 86%, Cynomolgus monkey - 98%

Alternative gene names: KIAA1196

Alternative protein names: Zinc finger protein 512B

Protein name: zinc finger protein 512B

Full length: 892 amino acids

Entry name: Z512B_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3472-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3472-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 57473