Recombinant Human ZNF597 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96LX8

Gene Name: ZNF597

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Val21

End Site: Val130

Coverage: 0.28

Isoelectric Point: 4.5

Core Sequence: VYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPEINQQLSLESMELDELALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLLVTIENHTPLV

Homologies: Highest protein sequence identity to the following orthologs: Pig - 74%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Zinc finger protein 597

Protein name: zinc finger protein 597

Full length: 424 amino acids

Entry name: ZN597_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3473-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3473-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 146434