Recombinant Human ZNF616 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q08AN1

Gene Name: ZNF616

Expression System: Escherichia coli

Molecular Weight: 29 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Asp11

End Site: Ser240

Coverage: 0.30

Isoelectric Point: 7

Core Sequence: DVAIEFSQEEWKCLEPVQKALYKDVMLENYRNLVFLGISPKCVIKELPPTENSNTGERFQTVALERHQSYDIENLYFREIQKHLHDLEFQWKDGETNDKEVPVPHENNLTGKRDQHSQGDVENNHIENQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCNECGKAFKASSSLINHQRIHTTEKPYKCNECGKAFHRASLLTVHKVVHTRGKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Rat - 35%, Pig - 40%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Zinc finger protein 616

Protein name: zinc finger protein 616

Full length: 781 amino acids

Entry name: ZN616_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3602-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3602-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 90317