Recombinant Human ZNF669 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96BR6

Gene Name: ZNF669

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 47%

Start Site: Ala91

End Site: Glu180

Coverage: 0.20

Isoelectric Point: 5

Core Sequence: AFEDVAVNFTQEEWALLDSSQKNLYREVMQETCRNLASVGSQWKDQNIEDHFEKPGKDIRNHIVQRLCESKEDGQYGEVVSQIPNLDLNE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 47%, Rat - 52%, Pig - 60%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Zinc finger protein 669

Protein name: zinc finger protein 669

Full length: 464 amino acids

Entry name: ZN669_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3629-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3629-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 79862