Recombinant Human ZNF704 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZNC4

Gene Name: ZNF704

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Lys11

End Site: Val90

Coverage: 0.21

Isoelectric Point: 7.5

Core Sequence: KRDCGKKMSHQHVFSLAMEEDVKTADTKKASRILDHEKENTRSICLLEQKRKVVSSNIDVPPARKSSEELDMDKVTAAMV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Pig - 92%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 704

Protein name: zinc finger protein 704

Full length: 412 amino acids

Entry name: ZN704_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3479-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3479-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 619279