Recombinant Human ZNF772 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q68DY9

Gene Name: ZNF772

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: His241

End Site: Met320

Coverage: 0.16

Isoelectric Point: 8.5

Core Sequence: HAPHNEWKPHSNTKCEEASHCGKRHYKCSECGKTFSRKDSLVQHQRVHTGERPYECGECGKTFSRKPILAQHQRIHTGEM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 67%, Pig - 78%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 772

Protein name: zinc finger protein 772

Full length: 489 amino acids

Entry name: ZN772_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3495-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3495-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 400720