Recombinant Human ZNF780B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6R6

Gene Name: ZNF780B

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Asn571

End Site: Phe650

Coverage: 0.11

Isoelectric Point: 10.5

Core Sequence: NLNQHRSIHTGKKPFECKECGKAFRLHMHLIRHQKFHTGEKPFECKECGKAFSLHTQLNHHKNIHTGEKPFKCKECGKSF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 63%, Pig - 66%, Cynomolgus monkey - 98%

Alternative gene names: ZNF779

Alternative protein names: Zinc finger protein 780B; Zinc finger protein 779

Protein name: zinc finger protein 780B

Full length: 833 amino acids

Entry name: Z780B_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3542-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3542-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 163131