Recombinant Human ZNF840P Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A6NDX5

Gene Name: ZNF840P

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 54%

Start Site: Arg481

End Site: Ile570

Coverage: 0.13

Isoelectric Point: 11

Core Sequence: RFNNNSNLNKHKKIHTGEKHFVCNQCGKAFSLNSKLSRHQRTHNKKENSSKSVSNLNKHQKTHAGEKPFPCNECKKAFAQRMDLARHQQI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 54%, Rat - 54%, Pig - 53%, Cynomolgus monkey - 94%

Alternative gene names: C20orf157; ZNF840

Alternative protein names: Putative zinc finger protein 840; Zinc finger protein 840 pseudogene

Protein name: zinc finger protein 840, pseudogene

Full length: 716 amino acids

Entry name: ZN840_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3611-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3611-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 100533646