Recombinant Human ZNF876P Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q49A33

Gene Name: ZNF876P

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: His81

End Site: Lys150

Coverage: 0.39

Isoelectric Point: 9.5

Core Sequence: HKNIHTGEKSYKCEECGNAFYRSSHLTKHKRIHSGQKPYKCEECGKAFRQSSALNEHKKIHTAEKPYKCK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 61%, Pig - 68%, Cynomolgus monkey - 81%

Alternative gene names: /

Alternative protein names: Putative zinc finger protein 876

Protein name: zinc finger protein 876, pseudogene

Full length: 203 amino acids

Entry name: Z876P_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3506-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3506-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 642280