Recombinant Human ZSCAN32 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NX65

Gene Name: ZSCAN32

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ile361

End Site: Thr460

Coverage: 0.15

Isoelectric Point: 5.5

Core Sequence: IEAGELNHQNGEPTEVEDGTVDGADRDEKDFRNPGQEVRKLDLPVLFPNRLGFEFKNEIKKENLKWDDSEEVEINKALQRKSRGVYWHSELQKGLESEPT

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 95%

Alternative gene names: ZNF434

Alternative protein names: Zinc finger and SCAN domain-containing protein 32; Human cervical cancer suppressor gene 5 protein; HCCS-5; Zinc finger protein 434

Protein name: zinc finger and SCAN domain containing 32

Full length: 697 amino acids

Entry name: ZSC32_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3390-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3390-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 54925