RPLV Recombinant Protein (Anaplasma phagocytophilum)

Description of Target: This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome.

Key Reference: Comparative genomics of emerging human ehrlichiosis agents.Dunning Hotopp J.C., Lin M., Madupu R., Crabtree J.Tettelin H. PLoS Genet. 2:208-222(2006).

Molecular Weight: 32.2 kDa.

Product Format: Liquid or Lyophilized powder.

Protein Name: 50S ribosomal protein L22.

Protein Sequence: MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER.

Protein Size: 1-112 aa.

Purity: Greater than 90% as determined by SDS-PAGE.

Source: in vitro E. Coli expression system.

Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

• Artikelnummer: AVIOPCA05373-20
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: OPCA05373-20
• Green Labware: Nein
• Verpackungseinheit: 20µg
• Mengeneinheit: STK
• Reaktivität: Various species
• Human Gene ID: 3930326