SFTPA1 Recombinant Protein (Human)

Description of Target: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.

Key Reference: Isolation and characterization of the human pulmonary surfactant apoprotein gene.White R.T., Damm D., Miller J., Spratt K., Schilling J., Hawgood S., Benson B., Cordell B.Nature 317:361-363(1985).

Molecular Weight: 41.2 kDa.

Product Format: Liquid or Lyophilized powder.

Protein Name: Pulmonary surfactant-associated protein A1.

Protein Sequence: EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF.

Protein Size: 21-248 aa.

Purity: Greater than 90% as determined by SDS-PAGE.

Source: in vitro E. Coli expression system.

Tag: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

• Artikelnummer: AVIOPCA05355-20
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: OPCA05355-20
• Green Labware: Nein
• Verpackungseinheit: 20µg
• Mengeneinheit: STK
• Reaktivität: Human
• Human Gene ID: 653509