SFTPB Recombinant Protein (Human)

Description of Target: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Key Reference: cDNA and deduced amino acid sequence of human pulmonary surfactant-associated proteolipid SPL(Phe). Glasser S.W., Korfhagen T.R., Weaver T., Pilot-Matias T., Fox J.L., Whitsett J.A. Proc. Natl. Acad. Sci. U.S.A. 84:4007-4011(1987).

Molecular Weight: 24.7 kDa.

Product Format: Liquid or Lyophilized powder.

Protein Name: Pulmonary surfactant-associated protein B.

Protein Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM.

Protein Size: 201-279 aa.

Purity: Greater than 90% as determined by SDS-PAGE.

Source: in vitro E. Coli expression system.

Tag: N-terminal 6xHis-SUMO-tagged

• Artikelnummer: AVIOPCA05381-20
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: OPCA05381-20
• Verpackungseinheit: 20µg
• Mengeneinheit: STK
• Reaktivität: Human
• Human Gene ID: 6439