Target: SUR2A
Conjugate: HRP
Product Type: Monoclonal
Clone Number: N319A/14 (Formerly sold as S319A-14)
Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Swiss-Prot: P70170
Purification: Protein G Purified
Storage Buffer: 73.64mM Carbonate, 54.55mM Ethanolamine, 45.45mM Cyanoborohydride, 18.18mM Sodium Hydroxide and 0.23mM Citrate in dH2O
Concentration: 1 mg/ml
Specificity: Detects ~120kDa. Does not cross-react with SUR2B.
Cellular Localization: Membrane
Scientific Background: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
References: 1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042.2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.