SUR2A Antibody, Clone N319A/14: PerCP

Mouse Anti-Mouse SUR2A Monoclonal IgG2A
Artikelnummer
STRSMC-431D-PCP
Verpackungseinheit
100 µg
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: SUR2A

Conjugate: PerCP

Product Type: Monoclonal

Clone Number: N319A/14 (Formerly sold as S319A-14)

Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Swiss-Prot: P70170

Purification: Protein G Purified

Storage Buffer: 95.64mM Phosphate, 2.48mM MES and 2mM EDTA

Concentration: 1 mg/ml

Specificity: Detects ~120kDa. Does not cross-react with SUR2B.

Cellular Localization: Membrane

Scientific Background: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).

References: 1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042.2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Mehr Informationen
Artikelnummer STRSMC-431D-PCP
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SMC-431D-PCP
Verpackungseinheit 100 µg
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus)
Klonalität Monoclonal
Methode Immunofluorescence, Western Blotting, ELISA, Immunohistochemistry, Immunocytochemistry
Isotyp IgG2a
Human Gene ID 20928
Wirt Mouse
Konjugat Conjugated, PerCP
Produktinformation (PDF) Download
MSDS (PDF) Download