TCN1 Recombinant Protein (Pig)

Description of Target: Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach.

Key Reference: Isolation and characterization of a cDNA encoding porcine gastric haptocorrin. Hewitt J.E., Seetharam B., Leykam J.F., Alpers D.H. Eur. J. Biochem. 189:125-130(1990).

Molecular Weight: 48.3 kDa.

Product Format: Liquid or Lyophilized powder.

Protein Name: Transcobalamin-1.

Protein Sequence: CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI.

Protein Size: 25-416 aa.

Purity: Greater than 90% as determined by SDS-PAGE.

Source: in vitro E. Coli expression system.

Tag: N-terminal 6xHis-tagged

• Artikelnummer: AVIOPCA05377-20
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: OPCA05377-20
• Verpackungseinheit: 20µg
• Mengeneinheit: STK
• Reaktivität: Pig (Porcine)