TECTB Recombinant Protein (Mouse)

Description of Target: One of the major non-collagenous components of the tectorial membrane.

Key Reference: The mouse tectorins. Modular matrix proteins of the inner ear homologous to components of the sperm-egg adhesion system.Legan P.K., Rau A., Keene J.N., Richardson G.P.J. Biol. Chem. 272:8791-8801(1997).

Molecular Weight: 36.5 kDa.

Product Format: Liquid or Lyophilized powder.

Protein Name: Beta-tectorin.

Protein Sequence: KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA.

Protein Size: 18-305 aa.

Purity: Greater than 90% as determined by SDS-PAGE.

Source: in vitro E. Coli expression system.

Tag: N-terminal 6xHis-tagged

• Artikelnummer: AVIOPCA05348-20
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: OPCA05348-20
• Green Labware: Nein
• Verpackungseinheit: 20µg
• Mengeneinheit: STK
• Reaktivität: Mouse (Murine)
• Human Gene ID: 21684