Key Reference: Analysis of the protein-coding content of the sequence of human cytomegalovirus strain AD169.Chee M.S., Bankier A.T., Beck S., Bohni R., Brown C.M., Cerny R., Horsnell T., Hutchison C.A. III, Kouzarides T., Martignetti J.A., Preddie E., Satchwell S.C., Tomlinson P., Weston K.M., Barrell B.G.Curr. Top. Microbiol. Immunol. 154:125-169(1990).
Molecular Weight: 24.2 kDa.
Product Format: Liquid or Lyophilized powder.
Protein Name: Uncharacterized protein UL131.
Protein Sequence: MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR.
Protein Size: 1-76 aa.
Purity: Greater than 90% as determined by SDS-PAGE.
Source: in vitro E. Coli expression system.
Tag: N-terminal 6xHis-SUMO-tagged