Description of Target: Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion.
Key Reference: Real-time PCR system for detection of orthopoxviruses and simultaneous identification of smallpox virus.Olson V.A., Laue T., Laker M.T., Babkin I.V., Drosten C., Shchelkunov S.N., Niedrig M., Damon I.K., Meyer H.J. Clin. Microbiol. 42:1940-1946(2004).
Molecular Weight: 15.0 kDa.
Product Format: Liquid or Lyophilized powder.
Protein Name: 14 kDa fusion protein.
Protein Sequence: MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE.
Protein Size: 1-110 aa.
Purity: Greater than 90% as determined by SDS-PAGE.
Source: Mammalian cell.
Tag: N-terminal 10xHis-tagged