AATF Antibody (aa171-220)

AATF Antibody (aa171-220)
Artikelnummer
LIFLS-B17062-50
Verpackungseinheit
50 µl
Hersteller
LSBio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Specificity: Human AATF

Antibody Modification: Unconjugated

Antigen Modification: aa171-220

Presentation: PBS, 0.09% sodium azide, 2% sucrose

Immunogen: Synthetic peptide located between aa171-220 of human AATF (Q9NY61, NP_036270) within the region EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Rabbit (100%); Monkey, Elephant (92%); Marmoset (91%); Galago (85%); Bat, Horse (84%).

Gene: AATF

Description: AATF antibody LS-B17062 is an unconjugated rabbit polyclonal antibody to human AATF (aa171-220). Validated for IHC and WB.

Synonyms: AATF, CHE1, DED, Rb-binding protein Che-1, CHE-1, Protein AATF

Recommended Storage: Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.
Mehr Informationen
Artikelnummer LIFLS-B17062-50
Hersteller LSBio
Hersteller Artikelnummer LS-B17062-50
Verpackungseinheit 50 µl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Immunohistochemistry (paraffin), Western Blotting, Immunohistochemistry
Isotyp IgG
Human Gene ID 26574
Wirt Rabbit
Konjugat Unconjugated
Produktinformation (PDF)
×
MSDS (PDF)
×