ABHD15 Antibody - middle region : Biotin

ABHD15 Antibody - middle region : Biotin
Artikelnummer
AVIARP53459_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC116236

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: LLALERGYYPVIFHRRGHHGCPLVSPRLQPFGDPSDLKEAVTYIRFRHPA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Abhydrolase domain-containing protein 15

Protein Size: 468

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53459_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53459_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 116236
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×