ABHD7 Antibody - N-terminal region : FITC

ABHD7 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55651_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of ABHD7 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABHD7

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epoxide hydrolase 4

Protein Size: 362

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55651_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55651_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 253152
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×