ABHD7 Antibody - N-terminal region : HRP

ABHD7 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55651_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of ABHD7 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABHD7

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Epoxide hydrolase 4

Protein Size: 362

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55651_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55651_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 253152
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×