ACADS Antibody - middle region : HRP

ACADS Antibody - middle region : HRP
Artikelnummer
AVIARP54276_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency. This gene encodes a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACADS

Key Reference: Tein,I., (2008) Mol. Genet. Metab. 93 (2), 179-189

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Short-chain specific acyl-CoA dehydrogenase, mitochondrial

Protein Size: 412

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54276_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54276_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 35
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×