ACADVL Antibody - C-terminal region : Biotin

ACADVL Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54487_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACADVL

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial

Protein Size: 633

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54487_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54487_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 37
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×