ACAP2 Antibody - C-terminal region : HRP

ACAP2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54874_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ACAP2 is a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACAP2

Key Reference: N/A

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: ARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2

Protein Size: 778

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54874_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54874_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23527
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×