Acbd3 Antibody - middle region : FITC

Acbd3 Antibody - middle region : FITC
Artikelnummer
AVIARP57650_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mouse homolog associates with peripheral-type benzodiazepine receptor and the regulatory subunit RIalpha of PKA.

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgi resident protein GCP60

Protein Size: 526

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57650_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57650_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 289312
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×