Acbd3 Antibody - middle region : HRP

Acbd3 Antibody - middle region : HRP
Artikelnummer
AVIARP57650_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mouse homolog associates with peripheral-type benzodiazepine receptor and the regulatory subunit RIalpha of PKA.

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Golgi resident protein GCP60

Protein Size: 526

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57650_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57650_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 289312
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×