ACBD7 Antibody - middle region : FITC

ACBD7 Antibody - middle region : FITC
Artikelnummer
AVIARP56266_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ACBD7 binds medium- and long-chain acyl-CoA esters.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ACBD7

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: KQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acyl-CoA-binding domain-containing protein 7

Protein Size: 88

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56266_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56266_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 414149
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×