ACBD7 Antibody - middle region : HRP

ACBD7 Antibody - middle region : HRP
Artikelnummer
AVIARP56266_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ACBD7 binds medium- and long-chain acyl-CoA esters.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ACBD7

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: KQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Acyl-CoA-binding domain-containing protein 7

Protein Size: 88

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56266_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56266_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 414149
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×