ACBD7 Antibody - N-terminal region : Biotin

ACBD7 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56265_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACBD7

Key Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acyl-CoA-binding domain-containing protein 7

Protein Size: 88

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56265_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56265_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 414149
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×