ACHE Antibody - N-terminal region : FITC

ACHE Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56761_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood gro

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACHE

Key Reference: Johnson,G., (2008) Biochem. J. 411 (3), 507-514

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acetylcholinesterase

Protein Size: 617

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56761_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56761_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Immunofluorescence, Western Blotting, Immunohistochemistry
Human Gene ID 43
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×