ACHE Antibody - N-terminal region : HRP

ACHE Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56761_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood gro

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACHE

Key Reference: Johnson,G., (2008) Biochem. J. 411 (3), 507-514

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Acetylcholinesterase

Protein Size: 617

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56761_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56761_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Immunofluorescence, Western Blotting, Immunohistochemistry
Human Gene ID 43
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×