ACOT11 Antibody - middle region : Biotin

ACOT11 Antibody - middle region : Biotin
Artikelnummer
AVIARP55280_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACOT11

Molecular Weight: 65

Peptide Sequence: Synthetic peptide located within the following region: AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acyl-coenzyme A thioesterase 11

Protein Size: 594

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55280_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55280_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26027
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×